Genomic loci for this biosynthetic pathway

Cluster Type From To
The following clusters are from record BGC0000525.1:
Cluster 1RiPP13837

BGC0000525, lichenicidin VK21 A1 / lichenicidin VK21 A2 biosynthetic gene cluster from Bacillus licheniformis. Locus 1. Partial MIBiG entry.

Chemical compounds

Compound: lichenicidin VK21 A1

Class-specific details

Biosynthetic class(es):
RiPP
RiPP subclass:
Lanthipeptide

Gene cluster description

lichenicidin VK21 A1 / lichenicidin VK21 A2 (BGC0000525). Gene Cluster 1. Biosynthetic class = RiPP. GenBank GU949560. Click on genes for more information.

Legend:

biosynthetic genes
transport-related genes
regulatory genes
other genes

Detailed annotation

lchA2 leader / core peptide, putative Class II
MKTMKNSAAREAFKGANHPAGMVSEEELKALVGG - NDVNPEDhbDhbPADhbDhbDhaDhaWDhbCIDhbAGVDhbVDhaADhaLCPDhbDhbKCDhbDhaRC
lchA1 leader / core peptide, putative Class II
MSKKEMILSWKNPMYRTESSYHPAGNILKELQEEEQHSIAGG - DhbIDhbLDhaDhbCAILDhaKPLGNNGYLCDhbVDhbKECMPDhaCN

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Literature references

1. Shenkarev ZO et al. (2010) Isolation, structure elucidation, and synergistic antibacterial activity of a novel two-component lantibiotic lichenicidin from Bacillus licheniformis VK21. Biochemistry 49(30):6462-72. doi: 10.1021/bi100871b.