BGC0000525 - 1 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

BGC0000525 (Bacillus licheniformis)

Region	Type	From	To	Most similar known cluster		Similarity
Region 1	lanthipeptide-class-ii	1	3,837

BGC0000525 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 1 - 3,837 nt. (total: 3,837 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG

MIBiG comparison

KnownClusterBlast

Lanthipeptides

External annotation

Name		MIBiG
Version		3.0

Type		Subregion
Location		1 - 3,838
Label		BGC0000525

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.1	1.00	RiPP	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0001579.1	0.20	RiPP	duramycin	Streptomyces cinnamoneus
BGC0000528.1	0.19	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000554.1	0.19	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000504.1	0.17	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000516.1	0.17	RiPP	geobacillin II	Geobacillus thermodenitrificans
BGC0001210.1	0.17	RiPP	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001576.1	0.15	RiPP	divamide A	Prochloron didemni
BGC0001364.1	0.15	RiPP	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0001311.1	0.14	RiPP	flavecins	Ruminococcus flavefaciens FD-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.1	1.00	RiPP	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0001579.1	0.52	RiPP	duramycin	Streptomyces cinnamoneus
BGC0000528.1	0.51	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000554.1	0.50	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000504.1	0.49	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000516.1	0.48	RiPP	geobacillin II	Geobacillus thermodenitrificans
BGC0001210.1	0.47	RiPP	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001576.1	0.46	RiPP	divamide A	Prochloron didemni
BGC0001364.1	0.45	RiPP	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0001311.1	0.44	RiPP	flavecins	Ruminococcus flavefaciens FD-1

Similar known gene clusters

No matches found.

Lanthipeptide predictions

Lanthipeptide(s) for LchM1

lchA2

Leader:

MKTMKNSAAREAFKGANHPAGMVSEEELKALVGG

Core:

NDVNPETTPATTSSWTCITAGVTVSASLCPTTKCTSRC

Core with dehydrations:

NDVNPEDhbDhbPADhbDhbDhaDhaWDhbCysIDhbAGVDhbVDhaADhaLCysPDhbDhbKCysDhbDhaRCys

lchA1

Leader:

MSKKEMILSWKNPMYRTESSYHPAGNILKELQEEEQHSIAGG

Core:

TITLSTCAILSKPLGNNGYLCTVTKECMPSCN

Core with dehydrations:

DhbIDhbLDhaDhbCysAILDhaKPLGNNGYLCysDhbVDhbKECysMPDhaCysN

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

lchA2 - Class II

Cleavage pHMM score: 1.50

RODEO score: 0

Monoisotopic mass: 3632.8 Da

Molecular weight: 3635.0 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3653.0 Da N = 1; 3671.1 Da N = 2; 3689.1 Da N = 3; 3707.1 Da N = 4; 3725.1 Da N = 5; 3743.1 Da N = 6; 3761.2 Da N = 7; 3779.2 Da N = 8; 3797.2 Da N = 9; 3815.2 Da N = 10; 3833.2 Da N = 11

lchA1 - Class II

Cleavage pHMM score: 3.30

RODEO score: 0

Monoisotopic mass: 3230.6 Da

Molecular weight: 3232.8 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3250.8 Da N = 1; 3268.8 Da N = 2; 3286.9 Da N = 3; 3304.9 Da N = 4