BGC0001507 - 1 region(s) - antiSMASH results

BGC0001507 (Streptomyces olindensis)

Region	Type	From	To	Most similar known cluster		Similarity
Region 1	lassopeptide	1	3,506	anantin B1 / anantin B2	RiPP	80%

BGC0001507 - Region 1 - lassopeptide

Download region SVG

Location: 1 - 3,506 nt. (total: 3,506 nt) Show pHMM detection rules used

Region on contig edge.

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG

MIBiG comparison

KnownClusterBlast

Lasso peptides

External annotation

Name		MIBiG
Version		3.0

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001507.1	0.83	RiPP	anantin C	Streptomyces olindensis
BGC0001506.1	0.42	RiPP	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0002053.1	0.40	RiPP	ulleungdin	Streptomyces sp.
BGC0002074.1	0.37	RiPP	huascopeptin	Streptomyces huasconensis
BGC0001307.1	0.37	RiPP	chaxapeptin	Streptomyces leeuwenhoekii
BGC0001539.1	0.35	RiPP	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001673.1	0.35	RiPP	moomysin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001889.1	0.32	RiPP	fusilassin	Thermobifida fusca YX
BGC0001493.1	0.31	RiPP	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001921.1	0.27	Other	MS-271	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001507.1	0.94	RiPP	anantin C	Streptomyces olindensis
BGC0001506.1	0.73	RiPP	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0002053.1	0.72	RiPP	ulleungdin	Streptomyces sp.
BGC0002074.1	0.70	RiPP	huascopeptin	Streptomyces huasconensis
BGC0001307.1	0.69	RiPP	chaxapeptin	Streptomyces leeuwenhoekii
BGC0001539.1	0.68	RiPP	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001673.1	0.68	RiPP	moomysin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001889.1	0.65	RiPP	fusilassin	Thermobifida fusca YX
BGC0001493.1	0.65	RiPP	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001921.1	0.61	Other	MS-271	Streptomyces sp.

Similar known gene clusters

Lasso peptide predictions

allorf_0163_0351

Leader:

VQRVAARLPFVTVEDAMDEQTEFSTTEPYAPPTLTEVGEFNEDTL

Full core:

GFIGWGDDIFGHYSGDF

Putative macrolactam:

GFIGWGDD

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lasso peptides

Core peptide predictions

allorf_0163_0351 - Class II: Cleavage pHMM score: 3.30; RODEO score: 20; Monoisotopic mass: 1870.8 Da; Molecular weight: 1872.0 Da; Number of bridges: 0