BGC0002700 - 1 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

BGC0002700 (Bacillus nakamurai)

Region	Type	From	To	Most similar known cluster		Similarity
Region 1	lanthipeptide-class-iii	1	5,832

BGC0002700 - Region 1 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 1 - 5,832 nt. (total: 5,832 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG

MIBiG comparison

KnownClusterBlast

Lanthipeptides

External annotation

Name		MIBiG
Version		3.0

Type		Subregion
Location		1 - 5,833
Label		BGC0002700

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000501.1	0.26	RiPP	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.1	0.25	RiPP	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000496.1	0.23	RiPP	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000518.1	0.22	RiPP	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000563.1	0.20	RiPP	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000551.1	0.20	RiPP	SapB	Streptomyces coelicolor A3(2)
BGC0001210.1	0.16	RiPP	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000486.1	0.16	RiPP	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0000539.1	0.16	RiPP	nukacin ISK-1	Staphylococcus warneri
BGC0000620.1	0.16	RiPP	lacticin Q	Lactococcus lactis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000501.1	0.59	RiPP	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.1	0.59	RiPP	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000496.1	0.56	RiPP	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000518.1	0.54	RiPP	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000563.1	0.53	RiPP	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000551.1	0.53	RiPP	SapB	Streptomyces coelicolor A3(2)
BGC0001210.1	0.47	RiPP	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000486.1	0.47	RiPP	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0000539.1	0.47	RiPP	nukacin ISK-1	Staphylococcus warneri
BGC0000620.1	0.47	RiPP	lacticin Q	Lactococcus lactis

Similar known gene clusters

No matches found.

Lanthipeptide predictions

Lanthipeptide(s) for AXI58_13740

allorf_1023_1202

Leader:

MNTIHYVKGKEVKKMNAVLELQKLAHDTDGKGIAV

Core:

DATITTTWTVTTTSGFISSVSNNC

Core with dehydrations:

DADhbIDhbDhbDhbWDhbVDhbDhbDhbDhaGFIDhaDhaVDhaNNCys

allorf_1203_1349

Leader:

VRKMNAVLELQKLAHDTDGKGIAV

Core:

DATITTTWTVTTTSAFTSTVSNHC

Core with dehydrations:

DADhbIDhbDhbDhbWDhbVDhbDhbDhbDhaAFDhbDhaDhbVDhaNHCys

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

allorf_1023_1202 - Class III

Cleavage pHMM score: -2.60

RODEO score: 0

Monoisotopic mass: 2290.2 Da

Molecular weight: 2291.4 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2309.5 Da N = 1; 2327.5 Da N = 2; 2345.5 Da N = 3; 2363.5 Da N = 4; 2381.5 Da N = 5; 2399.6 Da N = 6; 2417.6 Da N = 7; 2435.6 Da N = 8; 2453.6 Da N = 9; 2471.6 Da N = 10; 2489.7 Da N = 11

allorf_1203_1349 - Class III

Cleavage pHMM score: -2.60

RODEO score: 0

Monoisotopic mass: 2311.2 Da

Molecular weight: 2312.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2330.5 Da N = 1; 2348.5 Da N = 2; 2366.5 Da N = 3; 2384.5 Da N = 4; 2402.6 Da N = 5; 2420.6 Da N = 6; 2438.6 Da N = 7; 2456.6 Da N = 8; 2474.6 Da N = 9; 2492.7 Da N = 10; 2510.7 Da N = 11; 2528.7 Da N = 12